PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C021689P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 213aa    MW: 24256.7 Da    PI: 8.4879
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C021689P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF72.34e-231561349
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     + ks +qvtfskRr+g++ KA ELS+LC+ae+av++fss+gk+y++
  MELO3C021689P1 15 LDKKSTQQVTFSKRRAGLFNKAAELSILCGAEIAVLVFSSRGKIYTF 61
                    678999****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.053565IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-31564IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.97E-26675IPR002100Transcription factor, MADS-box
CDDcd002652.56E-34678No hitNo description
PRINTSPR004041.2E-21727IPR002100Transcription factor, MADS-box
PfamPF003194.3E-221661IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-212742IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-214263IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MKKSLGRRKI EIKKLDKKST QQVTFSKRRA GLFNKAAELS ILCGAEIAVL VFSSRGKIYT  60
FGHPNVDALL DRFLTGNNTV PPKPAEAYLP IAELNRDLSK AEAEFEIEKR RAAERSRNSE  120
RFWWDEPLES MKIDELKRFR SSLVELRANV VERLEKIEDR HCVTPSIDIA ESIQWPETSS  180
IQLAAGNNHC LPSFHMAENR SVAMDWEAEI WG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819310.0LN681931.1 Cucumis melo genomic scaffold, anchoredscaffold00049.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008458954.11e-156PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A0A0LW531e-101A0A0A0LW53_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-34AGAMOUS-like 62